PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462888634
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family VOZ
Protein Properties Length: 494aa    MW: 54912.7 Da    PI: 4.8479
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462888634genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ420.62.7e-1291874031217
        VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdlsl 100
                p+ps+flgpkcalwdc rp+ gse+++dyc+ +ha laln++ +gt pv+rp+gidlkdg+lf al akvqgk+vgip+c+gaat+kspwna+elfdlsl
  462888634 187 PSPSQFLGPKCALWDCGRPVGGSEECRDYCNPYHAGLALNDDGLGTIPVMRPRGIDLKDGPLFTALIAKVQGKNVGIPVCKGAATSKSPWNAPELFDLSL 286
                89************************************************************************************************** PP

        VOZ 101 legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkv 200
                lege+irewlffd+prrafesgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqpss++ewhl+eyein++dalalyrle+k++d+kksak+k+
  462888634 287 LEGESIREWLFFDTPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSSNYEWHLFEYEINDSDALALYRLEFKSSDAKKSAKSKL 386
                **************************************************************************************************** PP

        VOZ 201 skdsladlqkklgrlta 217
                 ++sl+++q++++rlta
  462888634 387 PSSSLNEIQQQMVRLTA 403
                ***************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MGAPQNSHGN NVGIPDPPSE TLRLLQLAVA EEEDDATSKL ADPRSPLPVP DSHQNLYEHG  60
HGQDGWMRNA QQQGEGAQQS LEHGVQEGCG EVAAVANAMF SDQMYFMDHE LSIDDFLRDD  120
DDYKINLPES DQGSLNNIEG IDQLEHQQFN FPSDLPSHSS YVNVNNSVQD TGDVFVHMSD  180
MLTTICPSPS QFLGPKCALW DCGRPVGGSE ECRDYCNPYH AGLALNDDGL GTIPVMRPRG  240
IDLKDGPLFT ALIAKVQGKN VGIPVCKGAA TSKSPWNAPE LFDLSLLEGE SIREWLFFDT  300
PRRAFESGNR KQRSLPDYNG RGWHESRKQV MKDFGGLKRS YYMDPQPSSN YEWHLFEYEI  360
NDSDALALYR LEFKSSDAKK SAKSKLPSSS LNEIQQQMVR LTADSPVENK RTARSKPKSN  420
QKDSRANVYP ALNTPSQASA PNSYQQPVPQ MAFLNENVVY GPHLPHSENI VYGPHLPHVY  480
SAEGSSFWNP SDRA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961501.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-119VOZ1_ARATH; Transcription factor VOZ1
TrEMBLK3Z4V00.0K3Z4V0_SETIT; Uncharacterized protein
STRINGSi021568m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-112vascular plant one zinc finger protein